All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-ZFHX4 Antibody
Polyclonal Antibody against HUMAN ZFHX4
0.1 mg/ml
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & nucleoli fibrillar center.
Product details
- Target protein: zinc finger homeobox 4
- Target gene: ZFHX4
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000025255 (84%)RAT - ENSRNOG00000008765 (82%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- ESKDQENNCERPKESNVLHPNGECPVKSEPTEPGDEDEEDAYSNELDDEEVLGELTDSIGNKDFPLLNQSISPLSSSVLKFIEKGTSSSSATVSDDTEKKKQTAAVRASGSVASNYGISGKDFADA
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000008771
- Concentration: 0.1 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA023837 on the Human Protein Atlas
Target information
- Protein name: zinc finger homeobox 4
- Gene name: ZFHX4
- Alternative gene names: FLJ20980, ZFH4
- Ensembl: ENSG00000091656
- Entrez: 79776
- UniProt: Q86UP3
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (4)
- Loss-of-function of the Zinc Finger Homeobox 4 (ZFHX4) gene underlies a neurodevelopmental disordermedRxiv , . Epub 2024 Aug 82024 Aug 8
- The histone demethylase Kdm6b regulates subtype diversification of mouse spinal motor neurons during developmentNat Commun , 2022 Feb 17; 13:958. Epub 2022 Feb 172022 Feb 17
Did we miss your publication? Have you published using HPA023837? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.