Cart 0
HPA053770
plasminogen-like B1

Anti-PLGLB1 Antibody

Polyclonal Antibody against HUMAN PLGLB1

0.3 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
4 570,0 kr
Lowest price during the previous 30 days before discount: 4 352,0 kr
Download product datasheet
1 of 1

Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

1 of 1

Product details

  • Target protein: plasminogen-like B1
  • Target gene: PLGLB1
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000059481 (84%)RAT - ENSRNOG00000017223 (84%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • FTCRAFQYHSKEQQCVIMAENRKSSIIIRMRD
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: R71685
  • Concentration: 0.3 mg/ml

Applications

  • Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
    • Working concentration: 0.25-2 µg/ml
    • Fixation/Permeabilization: PFA/Triton X-100

Validation

Target information

  • Protein name: plasminogen-like B1
  • Gene name: PLGLB1
  • Alternative gene names: PLGLPRP-B
  • Ensembl: ENSG00000183281
  • Entrez: 5343
  • UniProt: Q02325

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (1)

  • Characterization data on the Human Protein AtlasThis antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.Human Protein Atlas

Did we miss your publication? Have you published using HPA053770? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.