All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-PLA2G6 Antibody
Polyclonal Antibody against HUMAN PLA2G6
0.1 mg/ml
Western blot analysis in human cell line HEL.
Product details
- Target protein: phospholipase A2, group VI (cytosolic, calcium-independent)
- Target gene: PLA2G6
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000042632 (91%)RAT - ENSRNOG00000012295 (91%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000044192
- Concentration: 0.1 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA001171 on the Human Protein Atlas
- Western Blot (WB)Validated in Western blot using relevant lysates (see Western blot application images above) Recombinant expression validation in WB using target protein overexpression.
Target information
- Protein name: phospholipase A2, group VI (cytosolic, calcium-independent)
- Gene name: PLA2G6
- Alternative gene names: iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9
- Ensembl: ENSG00000184381
- Entrez: 8398
- UniProt: O60733
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (3)
- Exploring therapeutic strategies for infantile neuronal axonal dystrophy (INAD/PARK14)eLife , 2023 Jan 16; 12:e82555. Epub 2023 Jan 162023 Jan 16
- Group VIA phospholipase A2 is a target for vasopressin signaling in the thick ascending limb.Am J Physiol Renal Physiol , 2012 Apr 1; 302(7):F865-74. Epub 2012 Jan 42012 Apr 1
Did we miss your publication? Have you published using HPA001171? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.