All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-MITF Antibody
- ChIP-Certified
Polyclonal Antibody against HUMAN MITF
0.1 mg/ml
Immunohistochemistry analysis in human skin and pancreas tissues using HPA003259 antibody. Corresponding MITF RNA-seq data are presented for the same tissues.
Product details
- Target protein: microphthalmia-associated transcription factor
- Target gene: MITF
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000035158 (88%)RAT - ENSRNOG00000008658 (87%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000014341
- Concentration: 0.1 mg/ml
Applications
- Chromatin Immunoprecipitation (ChIP) recommended conditions
- Working concentration: 1-10µg per reaction
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:500 - 1:1000
- Retrieval method: HIER pH6
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Chromatin Immunoprecipitation (ChIP)Validated for use in ChIP-Exo-Seq and other ChIP-based assays via chromatin immunoprecipitation followed by λ exonuclease digestion and next-generation DNA sequencing to precisely map protein-DNA interactions at single base pair resolution. *Please note not all antibody batches are validated for use in ChIP applications.
- Immunohistochemistry (IHC)Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. All IHC characterization data in 44 normal tissues and 20 cancers for HPA003259 on the Human Protein Atlas
- Western Blot (WB)Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Target information
- Protein name: microphthalmia-associated transcription factor
- Gene name: MITF
- Alternative gene names: bHLHe32, MI, WS2, WS2A
- Ensembl: ENSG00000187098
- Entrez: 4286
- UniProt: O75030
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (28)
- An MITF- and mTOR-dependent FLCN pathway suppresses TFE3-driven metastasis in melanomabioRxiv , . Epub 2024 Jul 122024 Jul 12
- A chronic signaling TGFb zebrafish reporter identifies immune response in melanomaeLife , 2024 Jun 14; 13:e83527. Epub 2024 Jun 142024 Jun 14
Did we miss your publication? Have you published using HPA003259? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.