Cart 0
APrEST83552
zinc finger protein 557

PrEST Antigen ZNF557

Recombinant protein fragment of Human ZNF557

On demand
Delivery time: On Demand
2 432,0 kr
Lowest price during the previous 30 days before discount: 2 316,0 kr
Download product datasheet

Product details

  • Target protein: zinc finger protein 557
  • Target gene: ZNF557
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000074500 (59%)RAT - ENSRNOG00000006684 (46%)
  • Fusion tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
  • Expression host: E. coli
  • Buffer: PBS and 1M Urea, pH 7.4.
    Material Safety Data Sheet
  • Purification method: IMAC purification
  • Purity: >80% by SDS-PAGE and Coomassie blue staining
  • Theoretical MW: 32 kDa including tags
  • Concentration: ≥0.5 mg/ml
  • Amino acid sequence: 
  • GELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGAT
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: Produced on demand. Contact support@atlasantibodies.com for more information.
  • Concentration: Lot dependent

Target information

  • Protein name: zinc finger protein 557
  • Gene name: ZNF557
  • Alternative gene names: MGC4054
  • Ensembl: ENSG00000130544
  • Entrez: 79230
  • UniProt: Q8N988

Shipping and storage

  • Shipping: Shipped in liquid form on wet ice.Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

References

    Did we miss your publication? Have you published using APrEST83552? Please let us know and we will be happy to include your reference on this page. Submit reference

    Researcher Contributions

      Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

      With Atlas Antibodies you get

      Guarantee Program

      All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

      Global Scientific Support

      From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

      World Wide Shipping

      Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

      Highly Validated Antibodies

      Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.