Cart 0
HPA020376
phosphoserine phosphatase

Anti-PSPH Antibody

Polyclonal Antibody against HUMAN PSPH

0.2 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
438,0 EUR
Lowest price during the previous 30 days before discount: 417,0 EUR
Download product datasheet
1 of 6

Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA020376 antibody. Corresponding PSPH RNA-seq data are presented for the same tissues.

Immunohistochemistry analysis in human fallopian tube and skeletal muscle tissues using HPA020376 antibody. Corresponding PSPH RNA-seq data are presented for the same tissues.

Product details

  • Target protein: phosphoserine phosphatase
  • Target gene: PSPH
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000029446 (92%)RAT - ENSRNOG00000000925 (93%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: B115600
  • Concentration: 0.2 mg/ml

Applications

  • Immunohistochemistry (IHC) recommended conditions
    • Dilution: 1:200 - 1:500
    • Retrieval method: HIER pH6
  • Western Blot (WB) recommended conditions
    • Working concentration: 0.04-0.4 µg/ml

Validation

Target information

  • Protein name: phosphoserine phosphatase
  • Gene name: PSPH
  • Alternative gene names: PSP
  • Ensembl: ENSG00000146733
  • Entrez: 5723
  • UniProt: P78330

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (9)

  • p63 orchestrates serine and one carbon metabolism enzymes expression in head and neck cancerCappello A, Tosetti G, Smirnov A, Ganini C, Yang X, Shi Y, Wang Y, Melino G, Bernassola F, Candi EBiol Direct , 2023 Nov 9; 18:73. Epub 2023 Nov 92023 Nov 9
  • Serine metabolism remodeling after platinum-based chemotherapy identifies vulnerabilities in a subgroup of resistant ovarian cancersVan Nyen T, Planque M, van Wagensveld L, Duarte JA, Zaal EA, Talebi A, Rossi M, Körner PR, Rizzotto L, Moens S, De Wispelaere W, Baiden-Amissah RE, Sonke GS, Horlings HM, Eelen G, Berardi E, Swinnen JV, Berkers CR, Carmeliet P, Lambrechts D, Davidson B, Agami R, Fendt SM, Annibali D, Amant FNat Commun , 2022 Aug 5; 13:4578. Epub 2022 Aug 52022 Aug 5
Did we miss your publication? Have you published using HPA020376? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.