All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-PHF6 Antibody
Polyclonal Antibody against HUMAN PHF6
0.1 mg/ml
Immunohistochemistry analysis in human epididymis and liver tissues using HPA001023 antibody. Corresponding PHF6 RNA-seq data are presented for the same tissues.
Product details
- Target protein: PHD finger protein 6
- Target gene: PHF6
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000025626 (98%)RAT - ENSRNOG00000002276 (98%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNESLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDK
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: I106293
- Concentration: 0.1 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA001023 on the Human Protein Atlas
- Immunohistochemistry (IHC)Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. All IHC characterization data in 44 normal tissues and 20 cancers for HPA001023 on the Human Protein Atlas
- Western Blot (WB)Validated in Western blot using relevant lysates (see Western blot application images above)
Target information
- Protein name: PHD finger protein 6
- Gene name: PHF6
- Alternative gene names: BFLS, BORJ, CENP-31, KIAA1823, MGC14797
- Ensembl: ENSG00000156531
- Entrez: 84295
- UniProt: Q8IWS0
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (10)
- PHF6-mediated transcriptional control of NSC via Ephrin receptors is impaired in the intellectual disability syndrome BFLSEMBO Rep , 2024 Mar 1; 25(3):1256-1281. Epub 2024 Mar 12024 Mar 1
- Molecular and clinical analyses of PHF6 mutant myeloid neoplasia provide their pathogenesis and therapeutic targetingNat Commun , 2024 Feb 28; 15:1832. Epub 2024 Feb 282024 Feb 28
Did we miss your publication? Have you published using HPA001023? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.