Cart 0
HPA019716
malate dehydrogenase 2, NAD (mitochondrial)

Anti-MDH2 Antibody

Polyclonal Antibody against HUMAN MDH2

0.2 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
4 570,0 kr
Lowest price during the previous 30 days before discount: 4 352,0 kr
Download product datasheet
1 of 8

Immunohistochemical staining of human duodenum, fallopian tube, kidney and liver using Anti-MDH2 antibody HPA019716 (A) shows similar protein distribution across tissues to independent antibody HPA019714 (B).

Immunohistochemical staining of human duodenum, fallopian tube, kidney and liver using Anti-MDH2 antibody HPA019716 (A) shows similar protein distribution across tissues to independent antibody HPA019714 (B).

Product details

  • Target protein: malate dehydrogenase 2, NAD (mitochondrial)
  • Target gene: MDH2
  • Verified species reactivity: Human, Mouse, Rat
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000019179 (98%)RAT - ENSRNOG00000001440 (98%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKI
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: C115668
  • Concentration: 0.2 mg/ml

Applications

  • Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
    • Working concentration: 0.25-2 µg/ml
    • Fixation/Permeabilization: PFA/Triton X-100
  • Immunohistochemistry (IHC) recommended conditions
    • Dilution: 1:50 - 1:200
    • Retrieval method: HIER pH6
  • Western Blot (WB) recommended conditions
    • Working concentration: 0.04-0.4 µg/ml

Validation

Target information

  • Protein name: malate dehydrogenase 2, NAD (mitochondrial)
  • Gene name: MDH2
  • Ensembl: ENSG00000146701
  • Entrez: 4191
  • UniProt: P40926

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (4)

  • BAP1 Loss Is Associated with Higher ASS1 Expression in Epithelioid Mesothelioma: Implications for Therapeutic StratificationBarnett SE, Kenyani J, Tripari M, Butt Z, Grosman R, Querques F, Shaw L, Silva LC, Goate Z, Marciniak SJ, Rassl DM, Jackson R, Lian LY, Szlosarek PW, Sacco JJ, Coulson JMMol Cancer Res , 2023 Jan 20; 21(5):411-427. Epub 2023 Jan 202023 Jan 20
  • Characterization of the Role of the Malate Dehydrogenases to Lung Tumor Cell SurvivalZhang B, Tornmalm J, Widengren J, Vakifahmetoglu-Norberg H, Norberg EJ Cancer , 2017 Jul 5; 8(11):2088-2096. Epub 2017 Jul 52017 Jul 5
Did we miss your publication? Have you published using HPA019716? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.