Cart 0
HPA001617
mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)

Anti-MASP1 Antibody

Polyclonal Antibody against HUMAN MASP1

0.1 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
438,0 EUR
Lowest price during the previous 30 days before discount: 417,0 EUR
Download product datasheet
1 of 1

Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & cytosol.

Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & cytosol.

1 of 1

Product details

  • Target protein: mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
  • Target gene: MASP1
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000022887 (88%)RAT - ENSRNOG00000001827 (88%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: A117207
  • Concentration: 0.1 mg/ml

Applications

  • Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
    • Working concentration: 0.25-2 µg/ml
    • Fixation/Permeabilization: PFA/Triton X-100

Validation

Target information

  • Protein name: mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
  • Gene name: MASP1
  • Alternative gene names: CRARFMASPPRSS5
  • Ensembl: ENSG00000127241
  • Entrez: 5648
  • UniProt: P48740

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (4)

  • Complement lectin pathway components MBL and MASP-1 promote haemostasis upon vessel injury in a microvascular bleeding modelGolomingi M, Kohler J, Jenny L, Hardy ET, Dobó J, Gál P, Pál G, Kiss B, Lam WA, Schroeder VFront Immunol , 2022 Aug 12; 13:948190. Epub 2022 Aug 122022 Aug 12
  • Distinct Roles of Classical and Lectin Pathways of Complement in Preeclamptic PlacentaeBelmonte B, Mangogna A, Gulino A, Cancila V, Morello G, Agostinis C, Bulla R, Ricci G, Fraggetta F, Botto M, Garred P, Tedesco FFront Immunol , 2022 May 31; 13:882298. Epub 2022 May 312022 May 31
Did we miss your publication? Have you published using HPA001617? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.