All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-HNF4G Antibody
Polyclonal Antibody against HUMAN HNF4G
0.3 mg/ml
Immunohistochemistry analysis in human small intestine and liver tissues using Anti-HNF4G antibody. Corresponding HNF4G RNA-seq data are presented for the same tissues.
Product details
- Target protein: hepatocyte nuclear factor 4, gamma
- Target gene: HNF4G
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000017688 (94%)RAT - ENSRNOG00000008971 (94%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000044810
- Concentration: 0.3 mg/ml
Applications
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:1000 - 1:2500
- Retrieval method: HIER pH6
Validation
- Immunohistochemistry (IHC)Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. All IHC characterization data in 44 normal tissues and 20 cancers for HPA005438 on the Human Protein Atlas
Target information
- Protein name: hepatocyte nuclear factor 4, gamma
- Gene name: HNF4G
- Alternative gene names: NR2A2
- Ensembl: ENSG00000164749
- Entrez: 3174
- UniProt: Q14541
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (5)
- HNF4G accelerates glioma progression by facilitating NRP1 transcriptionOncol Lett None2023 Feb 1
- Epithelial HNF4A shapes the intraepithelial lymphocyte compartment via direct regulation of immune signaling moleculesJ Exp Med , 2022 Jul 6; 219(8):e20212563. Epub 2022 Jul 62022 Jul 6
Did we miss your publication? Have you published using HPA005438? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.