All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-CFI Antibody
Polyclonal Antibody against HUMAN CFI
0.1 mg/ml
Immunohistochemical staining of human liver shows moderate positivity in erythrocytes.
Product details
- Target protein: complement factor I
- Target gene: CFI
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000058952 (67%)RAT - ENSRNOG00000053400 (66%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- GCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDG
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: A118069
- Concentration: 0.1 mg/ml
Applications
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:200 - 1:500
- Retrieval method: HIER pH6
Validation
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA001143 on the Human Protein Atlas
Target information
- Protein name: complement factor I
- Gene name: CFI
- Alternative gene names: C3b-INA, FI, IF, KAF
- Ensembl: ENSG00000205403
- Entrez: 3426
- UniProt: P05156
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (4)
- Plasma proteins elevated in severe asthma despite oral steroid use and unrelated to Type-2 inflammationEur Respir J , 2022 Feb 17; 59(2):2100142. Epub 2022 Feb 172022 Feb 17
- Fluid proteomics of CSF and serum reveal important neuroinflammatory proteins in blood–brain barrier disruption and outcome prediction following severe traumatic brain injury: a prospective, observational studyCrit Care , 2021 Mar 12; 25:103. Epub 2021 Mar 122021 Mar 12
Did we miss your publication? Have you published using HPA001143? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.