All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-CD276 Antibody
Polyclonal Antibody against HUMAN CD276
0.1 mg/ml
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
Product details
- Target protein: CD276 molecule
- Target gene: CD276
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000035914 (89%)RAT - ENSRNOG00000033608 (89%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000047494
- Concentration: 0.1 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA017139 on the Human Protein Atlas
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA017139 on the Human Protein Atlas
- Western Blot (WB)Validated in Western blot using relevant lysates (see Western blot application images above)
Target information
- Protein name: CD276 molecule
- Gene name: CD276
- Alternative gene names: B7-H3, B7H3, B7RP-2
- Ensembl: ENSG00000103855
- Entrez: 80381
- UniProt: Q5ZPR3
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (3)
- Large-scale analysis reveals the specific clinical and immune features of B7-H3 in gliomaOncoimmunology , 2018 Aug 23; 7(11):e1461304. Epub 2018 Aug 232018 Aug 23
- Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness.Clin Cancer Res , 2012 Jan 1; 18(1):105-17. Epub 2011 Nov 112012 Jan 1
Did we miss your publication? Have you published using HPA017139? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
- User Data, Western Blot KO, Customer SubmissionUndisclosed customer2018-04-26Western blot using Anti-CD276 (B7-H3) antibody (HPA017139) in U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line.
Western blot shows lysates of U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line.
PVDF membrane was probed with 0.5 ug/mL of Anti-CD276 (B7-H3) antibody (HPA017139). A specific band was detected for B7-H3 at approximately 95 kDa (as indicated) in the parental U2OS cell line, whereas in the knockout U2OS cell line no band was detected
The experiment was conducted under reducing conditions.
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.