All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-AXL Antibody
Polyclonal Antibody against HUMAN AXL
0.1 mg/ml
Western blot analysis in human cell line U-251 MG.
Product details
- Target protein: AXL receptor tyrosine kinase
- Target gene: AXL
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000002602 (84%)RAT - ENSRNOG00000020716 (87%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000060654
- Concentration: 0.1 mg/ml
Applications
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Western Blot (WB)Validated in Western blot using relevant lysates (see Western blot application images above)
Target information
- Protein name: AXL receptor tyrosine kinase
- Gene name: AXL
- Alternative gene names: JTK11, UFO
- Ensembl: ENSG00000167601
- Entrez: 558
- UniProt: P30530
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (6)
- A retrospective analysis of the correlation between AXL expression and clinical outcomes of patients with urothelial bladder carcinomaTransl Cancer Res , 2019 Jun; 8(3):976-9842019 Jun
- Integrated analysis of multiple receptor tyrosine kinases identifies Axl as a therapeutic target and mediator of resistance to sorafenib in hepatocellular carcinomaBr J Cancer , 2019 Feb 15; 120(5):512-521. Epub 2019 Feb 152019 Feb 15
Did we miss your publication? Have you published using HPA037422? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.