All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-APOBEC3G Antibody
Polyclonal Antibody against HUMAN APOBEC3G
0.2 mg/ml
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA001812 antibody. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.
Product details
- Target protein: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
- Target gene: APOBEC3G
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000040627 (39%)RAT - ENSRNOG00000015478 (39%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000027951
- Concentration: 0.2 mg/ml
Applications
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:200 - 1:500
- Retrieval method: HIER pH6
Validation
- Immunohistochemistry (IHC)Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. All IHC characterization data in 44 normal tissues and 20 cancers for HPA001812 on the Human Protein Atlas
Target information
- Protein name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
- Gene name: APOBEC3G
- Alternative gene names: bK150C2.7, CEM15, dJ494G10.1, FLJ12740, MDS019
- Ensembl: ENSG00000239713
- Entrez: 60489
- UniProt: Q9HC16
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (6)
- APOBEC3G expression correlates with unfavorable prognosis and immune infiltration in kidney renal clear cell carcinomaHeliyon , 2022 Dec 9; 8(12):e12191. Epub 2022 Dec 92022 Dec 9
- Defining early SIV replication and dissemination dynamics following vaginal transmissionSci Adv , 2019 May 29; 5(5):eaav7116. Epub 2019 May 292019 May 29
Did we miss your publication? Have you published using HPA001812? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.