Cart 0
HPA051856
CD248 molecule, endosialin

Anti-CD248 Antibody

Polyclonal Antibody against HUMAN CD248

0.2 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
4 570,0 kr
Lowest price during the previous 30 days before discount: 4 352,0 kr
Download product datasheet
1 of 6

Immunohistochemistry analysis in human placenta and liver tissues using HPA051856 antibody. Corresponding CD248 RNA-seq data are presented for the same tissues.

Immunohistochemistry analysis in human placenta and liver tissues using HPA051856 antibody. Corresponding CD248 RNA-seq data are presented for the same tissues.

Product details

  • Target protein: CD248 molecule, endosialin
  • Target gene: CD248
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000056481 (67%)RAT - ENSRNOG00000052685 (67%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: 000027959
  • Concentration: 0.2 mg/ml

Applications

  • Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
    • Working concentration: 0.25-2 µg/ml
    • Fixation/Permeabilization: PFA/Triton X-100
  • Immunohistochemistry (IHC) recommended conditions
    • Dilution: 1:50 - 1:200
    • Retrieval method: HIER pH6

Validation

Target information

  • Protein name: CD248 molecule, endosialin
  • Gene name: CD248
  • Alternative gene names: CD164L1TEM1
  • Ensembl: ENSG00000174807
  • Entrez: 57124
  • UniProt: Q9HCU0

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (4)

  • Endosialin/CD248 may be a potential therapeutic target to prevent the invasion and metastasis in osteosarcomaKondo Y, Honoki K, Kishi S, Mori S, Fujiwara-Tani R, Tsukamoto S, Fujii H, Kuniyasu H, Tanaka YOncol Lett , 2021 Dec 6; 23(2):42. Epub 2021 Dec 62021 Dec 6
  • Fibroblast activation and inflammation in frozen shoulderAkbar M, McLean M, Garcia-Melchor E, Crowe LA, McMillan P, Fazzi UG, Martin D, Arthur A, Reilly JH, McInnes IB, Millar NLPLoS One , 2019 Apr 23; 14(4):e0215301. Epub 2019 Apr 232019 Apr 23
Did we miss your publication? Have you published using HPA051856? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.