All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-PEX3 Antibody
Polyclonal Antibody against HUMAN PEX3
0.2 mg/ml
Immunohistochemical staining of human adrenal gland shows strong granular cytoplasm positivity in glandular cells.
Product details
- Target protein: peroxisomal biogenesis factor 3
- Target gene: PEX3
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000019809 (97%)RAT - ENSRNOG00000015660 (97%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- LDNMAEFFRPTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAANVYEAFSTPQQ
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000034932
- Concentration: 0.2 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:200 - 1:500
- Retrieval method: HIER pH6
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA042830 on the Human Protein Atlas
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA042830 on the Human Protein Atlas
Target information
- Protein name: peroxisomal biogenesis factor 3
- Gene name: PEX3
- Ensembl: ENSG00000034693
- Entrez: 8504
- UniProt: P56589
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (5)
- MicroRNA-25/93 induction by Vpu as a mechanism for counteracting MARCH1-restriction on HIV-1 infectivity in macrophagesmBio , 2023 Sep 29; 14(5):e01950-23. Epub 2023 Sep 292023 Sep 29
- Dengue and Zika Virus Capsid Proteins Contain a Common PEX19-Binding MotifViruses , 2022 Jan 27; 14(2):253. Epub 2022 Jan 272022 Jan 27
Did we miss your publication? Have you published using HPA042830? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.