All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-CEP162 Antibody
Polyclonal Antibody against HUMAN CEP162
0.1 mg/ml
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, as well as nuclear positivity in a subset of cells.
Product details
- Target protein: centrosomal protein 162kDa
- Target gene: CEP162
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000056919 (58%)RAT - ENSRNOG00000010608 (56%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000053685
- Concentration: 0.1 mg/ml
Applications
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:200 - 1:500
- Retrieval method: HIER pH6
Validation
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA030170 on the Human Protein Atlas
Target information
- Protein name: centrosomal protein 162kDa
- Gene name: CEP162
- Alternative gene names: C6orf84, KIAA1009, QN1
- Ensembl: ENSG00000135315
- Entrez: 22832
- UniProt: Q5TB80
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (5)
- Centriolar satellites expedite mother centriole remodeling to promote ciliogenesiseLife None2023 Feb 15
- Super-Resolution Imaging Reveals TCTN2 Depletion-Induced IFT88 Lumen Leakage and Ciliary WeakeningBiophys J , 2018 Jun 1; 115(2):263-275. Epub 2018 Jun 12018 Jun 1
Did we miss your publication? Have you published using HPA030170? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.