Cart 0
HPA027452
protein phosphatase 1, regulatory subunit 8

Anti-PPP1R8 Antibody

Polyclonal Antibody against HUMAN PPP1R8

0.1 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
4 311,0 kr
Lowest price during the previous 30 days before discount: 4 106,0 kr
Download product datasheet
1 of 2

Western blot analysis in human cell line NTERA-2.

Western blot analysis in human cell line NTERA-2.

1 of 2

Product details

  • Target protein: protein phosphatase 1, regulatory subunit 8
  • Target gene: PPP1R8
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000028882 (100%)RAT - ENSRNOG00000059550 (100%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • TFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNK
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: 000053546
  • Concentration: 0.1 mg/ml

Applications

  • Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
    • Working concentration: 0.25-2 µg/ml
    • Fixation/Permeabilization: PFA/Triton X-100
  • Western Blot (WB) recommended conditions
    • Working concentration: 0.04-0.4 µg/ml

Validation

Target information

  • Protein name: protein phosphatase 1, regulatory subunit 8
  • Gene name: PPP1R8
  • Alternative gene names: ard-1ARD1NIPP-1NIPP1PRO2047
  • Ensembl: ENSG00000117751
  • Entrez: 5511
  • UniProt: Q12972

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (6)

  • Alternating binding and p97-mediated dissociation of SDS22 and I3 recycles active PP1 between holophosphatasesKueck AF, van den Boom J, Koska S, Ron D, Meyer HProc Natl Acad Sci U S A , 2024 Aug 29; 121(36):e2408787121. Epub 2024 Aug 292024 Aug 29
  • PP1 regulatory subunit NIPP1 regulates transcription of E2F1 target genes following DNA damageHanaki S, Habara M, Masaki T, Maeda K, Sato Y, Nakanishi M, Shimada MCancer Sci , 2021 May 3; 112(7):2739-2752. Epub 2021 May 32021 May 3
Did we miss your publication? Have you published using HPA027452? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.