All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-VPS37A Antibody
Polyclonal Antibody against HUMAN VPS37A
0.4 mg/ml
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Product details
- Target protein: vacuolar protein sorting 37 homolog A (S. cerevisiae)
- Target gene: VPS37A
- Verified species reactivity: Human, Mouse, Rat
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000031600 (92%)RAT - ENSRNOG00000012001 (92%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- DVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTF
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: A117681
- Concentration: 0.4 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:200 - 1:500
- Retrieval method: HIER pH6
- Western Blot (WB) recommended conditions
- Working concentration: 0.04-0.4 µg/ml
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA024705 on the Human Protein Atlas
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA024705 on the Human Protein Atlas
- Western Blot (WB)Validated in Western blot using relevant lysates (see Western blot application images above)
Target information
- Protein name: vacuolar protein sorting 37 homolog A (S. cerevisiae)
- Gene name: VPS37A
- Alternative gene names: FLJ32642, HCRP1, PQBP2, SPG53
- Ensembl: ENSG00000155975
- Entrez: 137492
- UniProt: Q8NEZ2
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (2)
- Unveiling the physiological impact of ESCRT-dependent autophagosome closure by targeting the VPS37A ubiquitin E2 variant-like domainCell Rep , 2024 Nov 27; 43(12):115016. Epub 2024 Nov 272024 Nov 27
- Characterization data on the Human Protein AtlasThis antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.Human Protein Atlas
Did we miss your publication? Have you published using HPA024705? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.