All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Product details
- Target protein: WD repeat domain 60
- Target gene: WDR60
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000042050 (82%)RAT - ENSRNOG00000004520 (82%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- DIQTEEIETREVWTQHPGESTVVSGGSEQRDTSDAVVMPKIDTPRLCSFLRAACQVMAVLLEEDRLAAEPSWNLRAQDRALYFSDSSSQLNTSLPFLQNRKVSSLHTSRVQRQMVVSVH
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: A104574
- Concentration: 0.2 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA020607 on the Human Protein Atlas
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA020607 on the Human Protein Atlas
Target information
- Protein name: WD repeat domain 60
- Gene name: WDR60
- Alternative gene names: FAP163, FLJ10300
- Ensembl: ENSG00000126870
- Entrez: 55112
- UniProt: Q8WVS4
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (3)
- SRPS associated protein WDR60 regulates the multipolar-to-bipolar transition of migrating neurons during cortical developmentCell Death Dis , 2021 Jan 12; 12(1):75. Epub 2021 Jan 122021 Jan 12
- Subunit composition of the human cytoplasmic dynein-2 complexJ Cell Sci , 2014 Nov 1; 127(21):4774-47872014 Nov 1
Did we miss your publication? Have you published using HPA020607? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.