All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-IMPG2 Antibody
Polyclonal Antibody against HUMAN IMPG2
0.1 mg/ml
Immunohistochemical staining of human eye, retina, kidney, liver and pancreas using Anti-IMPG2 antibody HPA015907 (A) shows similar protein distribution across tissues to independent antibody HPA008779 (B).
Product details
- Target protein: interphotoreceptor matrix proteoglycan 2
- Target gene: IMPG2
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000035270 (49%)RAT - ENSRNOG00000001622 (48%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- FDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: 000056303
- Concentration: 0.1 mg/ml
Applications
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
Validation
- Immunohistochemistry (IHC)Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validated against independent antibody Anti-IMPG2 HPA008779 All IHC characterization data in 44 normal tissues and 20 cancers for HPA015907 on the Human Protein Atlas
Target information
- Protein name: interphotoreceptor matrix proteoglycan 2
- Gene name: IMPG2
- Alternative gene names: IPM200, RP56
- Ensembl: ENSG00000081148
- Entrez: 50939
- UniProt: Q9BZV3
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (3)
- Interphotoreceptor matrix proteoglycans IMPG1 and IMPG2 proteolyze in the SEA domain and reveal localization mutual dependencySci Rep , 2022 Sep 15; 12:15535. Epub 2022 Sep 152022 Sep 15
- Serum Autoantibody Profiling of Patients with Paraneoplastic and Non-Paraneoplastic Autoimmune RetinopathyPLoS One , 2016 Dec 8; 11(12):e0167909. Epub 2016 Dec 82016 Dec 8
Did we miss your publication? Have you published using HPA015907? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.