All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-ORAI3 Antibody
Polyclonal Antibody against HUMAN ORAI3
0.4 mg/ml
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in glial cells and neurons.
Product details
- Target protein: ORAI calcium release-activated calcium modulator 3
- Target gene: ORAI3
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000043964 (58%)RAT - ENSRNOG00000039730 (63%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: A97127
- Concentration: 0.4 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA015022 on the Human Protein Atlas
- Immunohistochemistry (IHC) All IHC characterization data in 44 normal tissues and 20 cancers for HPA015022 on the Human Protein Atlas
Target information
- Protein name: ORAI calcium release-activated calcium modulator 3
- Gene name: ORAI3
- Alternative gene names: MGC13024, TMEM142C
- Ensembl: ENSG00000175938
- Entrez: 93129
- UniProt: Q9BRQ5
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (5)
- Stim and Orai mediate constitutive Ca2+ entry and control endoplasmic reticulum Ca2+ refilling in primary cultures of colorectal carcinoma cellsOncotarget , 2018 Jul 24; 9(57):31098-31119. Epub 2018 Jul 242018 Jul 24
- VEGF-induced intracellular Ca2+ oscillations are down-regulated and do not stimulate angiogenesis in breast cancer-derived endothelial colony forming cellsOncotarget , 2017 Aug 14; 8(56):95223-95246. Epub 2017 Aug 142017 Aug 14
Did we miss your publication? Have you published using HPA015022? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.