All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.
Anti-MST1R Antibody
Polyclonal Antibody against HUMAN MST1R
0.3 mg/ml
Immunohistochemical staining of human cerebral cortex, gastrointestinal, lymph node and skin using Anti-MST1R antibody HPA008180 (A) shows similar protein distribution across tissues to independent antibody HPA007657 (B).
Product details
- Target protein: macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
- Target gene: MST1R
- Verified species reactivity: Human
- Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000032584 (74%)RAT - ENSRNOG00000032618 (69%)
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet - Purification method: Affinity purified using the PrEST antigen as affinity ligand
- Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
- Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Current lot
- Unit size: 100µl
- Current lot: B43373
- Concentration: 0.3 mg/ml
Applications
- Immunofluorescence in Cell Lines (ICC-IF) recommended conditions
- Working concentration: 0.25-2 µg/ml
- Fixation/Permeabilization: PFA/Triton X-100
- Immunohistochemistry (IHC) recommended conditions
- Dilution: 1:50 - 1:200
- Retrieval method: HIER pH6
Validation
- Immunofluorescence in Cell Lines (ICC-IF) All ICC-IF characterization data for HPA008180 on the Human Protein Atlas
- Immunohistochemistry (IHC)Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validated against independent antibody Anti-MST1R HPA007657 All IHC characterization data in 44 normal tissues and 20 cancers for HPA008180 on the Human Protein Atlas
Target information
- Protein name: macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
- Gene name: MST1R
- Alternative gene names: CD136, CDw136, PTK8, RON
- Ensembl: ENSG00000164078
- Entrez: 4486
- UniProt: Q04912
Shipping and storage
- Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
References (3)
- Molecular landscape and subtype-specific therapeutic response of nasopharyngeal carcinoma revealed by integrative pharmacogenomicsNat Commun , 2021 May 24; 12:3046. Epub 2021 May 242021 May 24
- The Receptor Tyrosine Kinase RON and Its Isoforms as Therapeutic Targets in Ewing SarcomaCancers (Basel) , 2020 Apr 7; 12(4):904. Epub 2020 Apr 72020 Apr 7
Did we miss your publication? Have you published using HPA008180? Please let us know and we will be happy to include your reference on this page. Submit reference
Researcher Contributions
Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...
Alternative antibodies
Corresponding antigens
With Atlas Antibodies you get
From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.
Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.
Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.