Cart 0
HPA002739
contactin associated protein-like 2

Anti-CNTNAP2 Antibody

Polyclonal Antibody against HUMAN CNTNAP2

0.1 mg/ml
In Stock (10+)
Delivery time: Ready to Ship
4 570,0 kr
Lowest price during the previous 30 days before discount: 4 352,0 kr
Download product datasheet
1 of 6

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA002739 antibody. Corresponding CNTNAP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA002739 antibody. Corresponding CNTNAP2 RNA-seq data are presented for the same tissues.

Product details

  • Target protein: contactin associated protein-like 2
  • Target gene: CNTNAP2
  • Verified species reactivity: Human
  • Interspecies information: Highest antigen sequence indentity to the following orthologs: MOUSE - ENSMUSG00000039419 (85%)RAT - ENSRNOG00000011231 (36%)
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
    Material Safety Data Sheet
  • Purification method: Affinity purified using the PrEST antigen as affinity ligand
  • Antigen sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSS
  • Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Current lot

  • Unit size: 100µl
  • Current lot: 000050545
  • Concentration: 0.1 mg/ml

Applications

  • Immunohistochemistry (IHC) recommended conditions
    • Dilution: 1:200 - 1:500
    • Retrieval method: HIER pH6
  • Western Blot (WB) recommended conditions
    • Working concentration: 0.04-0.4 µg/ml

Validation

Target information

  • Protein name: contactin associated protein-like 2
  • Gene name: CNTNAP2
  • Alternative gene names: Caspr2KIAA0868NRXN4
  • Ensembl: ENSG00000174469
  • Entrez: 26047
  • UniProt: Q9UHC6

Shipping and storage

  • Shipping: Normally shipped at ambient temperatureStorage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References (3)

  • Contactin-associated protein-like 2 (CNTNAP2) mutations impair the essential α-secretase cleavages, leading to autism-like phenotypesZhang Q, Xing M, Bao Z, Xu L, Bai Y, Chen W, Pan W, Cai F, Wang Q, Guo S, Zhang J, Wang Z, Wu Y, Zhang Y, Li JD, Song WSignal Transduct Target Ther , 2024 Mar 1; 9:51. Epub 2024 Mar 12024 Mar 1
  • Genome-wide association study with DNA pooling identifies variants at CNTNAP2 associated with pseudoexfoliation syndromeKrumbiegel M, Pasutto F, Schlötzer-Schrehardt U, Uebe S, Zenkel M, Mardin CY, Weisschuh N, Paoli D, Gramer E, Becker C, Ekici AB, Weber BH, Nürnberg P, Kruse FE, Reis AEur J Hum Genet , 2011 Feb; 19(2):186-193. Epub 2010 Sep 12011 Feb
Did we miss your publication? Have you published using HPA002739? Please let us know and we will be happy to include your reference on this page. Submit reference

Researcher Contributions

    Join the Explorer Program Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order. Read more...

    With Atlas Antibodies you get

    Guarantee Program

    All products are designed for the highest possible performance and are manufactured using a standardized process to ensure the most rigorous levels of quality.

    Global Scientific Support

    From our facilities in Stockholm, Sweden we develop, manufacture and distribute highly advanced reagents to the Life Sciences community worldwide.

    World Wide Shipping

    Our products are available to customers worldwide. From most locations, you can order our products from Atlas Antibodies. Please see more information about how to order here.

    Highly Validated Antibodies

    Learn how we validate our antibodies, how we secure their reproducibility, and why we apply enhanced validation. Our antibodies are validated in IHC, ICC-IF, and WB.