ATRX Antibody (HPA001906)

ATRX Antibody (HPA001906)

Anti-ATRX

alpha thalassemia/mental retardation syndrome X-linked
Anti-ATRX
HPA001906
100 µl
$429.00
Available in stock
Clonality
Polyclonal
Alternative names
JMS, RAD54, XH2, XNP
Species reactivity
Human
Alternative Antibodies
Close
  • Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islet cells.
Immunohistochemistry
Recommended conditions:
  • Dilution: 1:200 - 1:500
  • Retrieval method: HIER pH6
Additional IHC Characterization Data
Access additional IHC-data for Anti-ATRX on the Human Protein Atlas. View manually annotated IHC-data from 576 human tissue samples of normal and cancer origin as well as duplicate samples from 59 clinical cell samples and cell lines.
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Specificity
Specific reactivity against target PrEST antigen validated on protein array with 384 randomly selected antigens.
Interspecies Information Highest antigen sequence identity to the following orthologos:
Form
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Vial Size 100 µl
Current Lot
B95498
Concentration
0.2 mg/ml
Storage Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Shipping
Normally shipped at ambient temperature
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Human Protein Atlas

This antibody has been used for staining of 48 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

Bolander A, Agnarsdóttir M, Strömberg S, Ponten F, Hesselius P, Uhlen M, Bergqvist M The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics Proteomics 2008 Nov-Dec;5(6):293-300 PubMed ID: 19287070
Schwartzentruber J, Korshunov A, Liu XY, Jones DT, Pfaff E, Jacob K, Sturm D, Fontebasso AM, Quang DA, Tönjes M, Hovestadt V, Albrecht S, Kool M, Nantel A, Konermann C, Lindroth A, Jäger N, Rausch T, Ryzhova M, Korbel JO, Hielscher T, Hauser P, Garami M, Klekner A, Bognar L, Ebinger M, Schuhmann MU, Scheurlen W, Pekrun A, Frühwald MC, Roggendorf W, Kramm C, Dürken M, Atkinson J, Lepage P, Montpetit A, Zakrzewska M, Zakrzewski K, Liberski PP, Dong Z, Siegel P, Kulozik AE, Zapatka M, Guha A, Malkin D, Felsberg J, Reifenberger G, von Deimling A, Ichimura K, Collins VP, Witt H, Milde T, Witt O, Zhang C, Castelo-Branco P, Lichter P, Faury D, Tabori U, Plass C, Majewski J, Pfister SM, Jabado N Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma. Nature 2012 Jan 29;482(7384):226-31 PubMed ID: 22286061 DOI: 10.1038/nature10833
Lovejoy CA, Li W, Reisenweber S, Thongthip S, Bruno J, de Lange T, De S, Petrini JH, Sung PA, Jasin M, Rosenbluh J, Zwang Y, Weir BA, Hatton C, Ivanova E, Macconaill L, Hanna M, Hahn WC, Lue NF, Reddel RR, Jiao Y, Kinzler K, Vogelstein B, Papadopoulos N, Meeker AK, for the ALT Starr Cancer Consortium Loss of ATRX, Genome Instability, and an Altered DNA Damage Response Are Hallmarks of the Alternative Lengthening of Telomeres Pathway PLoS Genet 2012 Jul; 8(7):e1002772. Epub 2012 Jul 19. PubMed ID: 22829774 DOI: 10.1371/journal.pgen.1002772
de Wilde RF, Heaphy CM, Maitra A, Meeker AK, Edil BH, Wolfgang CL, Ellison TA, Schulick RD, Molenaar IQ, Valk GD, Vriens MR, Borel Rinkes IH, Offerhaus GJ, Hruban RH, Matsukuma KE Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors. Mod Pathol 2012 Jul;25(7):1033-9 PubMed ID: 22575867 DOI: 10.1038/modpathol.2012.53
Heaphy CM, de Wilde RF, Jiao Y, Klein AP, Edil BH, Shi C, Bettegowda C, Rodriguez FJ, Eberhart CG, Hebbar S, Offerhaus GJ, McLendon R, Rasheed BA, He Y, Yan H, Bigner DD, Oba-Shinjo SM, Marie SK, Riggins GJ, Kinzler KW, Vogelstein B, Hruban RH, Maitra A, Papadopoulos N, Meeker AK Altered telomeres in tumors with ATRX and DAXX mutations. Science 2011 Jul 22;333(6041):425 PubMed ID: 21719641 DOI: 10.1126/science.1207313
Abedalthagafi M, Phillips JJ, Kim GE, Mueller S, Haas-Kogen DA, Marshall RE, Croul SE, Santi MR, Cheng J, Zhou S, Sullivan LM, Martinez-Lage M, Judkins AR, Perry A The alternative lengthening of telomere phenotype is significantly associated with loss of ATRX expression in high-grade pediatric and adult astrocytomas: a multi-institutional study of 214 astrocytomas. Mod Pathol 2013 Nov;26(11):1425-32 PubMed ID: 23765250 DOI: 10.1038/modpathol.2013.90

We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.

100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people

If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.

Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.

 

Forgot your email?