ANXA1 Antibody (AMAb90558)

ANXA1 Antibody (AMAb90558)

Anti-ANXA1

annexin A1
Anti-ANXA1
AMAb90558
100 µl
$429.00
Available in stock
Clonality
Monoclonal
Alternative names
ANX1, LPC1
Species reactivity
Human
Close
  • Immunohistochemical staining of human bronchus shows distinct positivity in ciliated epithelial cells.
  • Immunohistochemical staining of human lung shows nuclear positivity in a subset of pneumocytes and lymphoid cells.
  • Immunohistochemical staining of human bone marrow shows strong nuclear immunoreactivity in a subset of lymphoid cells.
  • Immunohistochemical staining of human fallopian tube shows strong positivity in the glandular cells.
  • Immunohistochemical staining of human placenta shows strong immunoreactivity in the trophoblast cells.
Immunohistochemistry
Recommended conditions:
  • Dilution: 1:500 - 1:1000
  • Retrieval method: HIER pH6
Close
  • Lane 1: Marker [kDa]
    Lane 2: Human cell line U-251 MG
Western Blot
Recommended conditions:
  • Dilution: 1:500 - 1:1000
Clonality
Monoclonal
Clone Number
CL0199
Isotype
IgG1
Host
Mouse
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV
Epitope
Binds to an epitope located within the peptide sequence PQLRRVFQKY as determined by overlapping synthetic peptides.
Purification Method
Protein A purified
Interspecies Information Highest antigen sequence identity to the following orthologos:
Form
The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Vial Size 100 µl
Current Lot
02575
Concentration
1.1 mg/ml
Storage Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Shipping
Normally shipped at ambient temperature
Notes
The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

We are an experienced team of researchers dedicated to helping you with any questions you have regarding our products and their applications.

100 researchers are working within the Human Protein Atlas project. Our Scientific Support Team provides you with answers or guide you to the right people

If you have questions or comments regarding this antibody please contact our Scientific Support: contact@atlasantibodies.com.

Are you using our antibodies in an application or in a species we have not yet validated? Go to our Technical Support and Resources page and read about our Explorer Program.

 

Forgot your email?